DPCfam | MC94090
Metacluster Properties and Pfam Annotations
| Number of UniRef50 seed sequences | 1101 |
|---|---|
| Mean domain length (aa) | 141 ± 21 aa |
| Residues in low-complexity regions (%) | 2.39 |
| Residues in coiled-coil regions (%) | 9.61 |
| Predicted disordered residues (%) | 20.62 |
| Average transmembrane regions | 0.02 |
| Dominant Pfam architecture(s) | PF00210 |
| Sequences matching dominant architecture (%) | 91.02 |
| Average overlap percent | 89.3 |
| Pfam Overlap Label | Equivalent |
Seed Sequences
| Protein ID | Range | Length | Seed Sequence |
|---|---|---|---|
| C1AD17 | 6-142 | 137 | TLAQALNTQIGNEFGASLQYYAIGAHFHRIHLAQLAKLFFKQADEEREHAQKLLHYVVETGGELRLPAVKEPVHTFASAEEALQA... |
Representative AlphaFold Structure
| AlphaFold ID | Sequence Range | HMM Coverage | Avg pLDDT | AlphaFold 3D Structure |
|---|---|---|---|---|
| AF-P85837-F1 | 9-155 | 99.31 | 98.39 | View in AlphaFoldDB ↗ |