DPCfam | MC9409
Metacluster Properties and Pfam Annotations
| Number of UniRef50 seed sequences | 1081 |
|---|---|
| Mean domain length (aa) | 77 ± 10 aa |
| Residues in low-complexity regions (%) | 0.79 |
| Residues in coiled-coil regions (%) | 0.0 |
| Predicted disordered residues (%) | 20.3 |
| Average transmembrane regions | 0 |
| Dominant Pfam architecture(s) | PF06602 |
| Sequences matching dominant architecture (%) | 97.56 |
| Average overlap percent | 32.19 |
| Pfam Overlap Label | Reduced |
Seed Sequences
| Protein ID | Range | Length | Seed Sequence |
|---|---|---|---|
| B0WIZ7 | 179-246 | 68 | LQGAWRISHANAEFKLCPSYPRLLLVPACIPDDTLQNVASFRSSRRIPAVVWRHERTGAVIARCSQPE... |
Representative AlphaFold Structure
| AlphaFold ID | Sequence Range | HMM Coverage | Avg pLDDT | AlphaFold 3D Structure |
|---|---|---|---|---|
| AF-Q5REB9-F1 | 214-293 | 98.77 | 98.29 | View in AlphaFoldDB ↗ |