DPCfam | MC9383
Metacluster Properties and Pfam Annotations
| Number of UniRef50 seed sequences | 171 |
|---|---|
| Mean domain length (aa) | 100 ± 9 aa |
| Residues in low-complexity regions (%) | 5.08 |
| Residues in coiled-coil regions (%) | 0.0 |
| Predicted disordered residues (%) | 36.58 |
| Average transmembrane regions | 0.02 |
| Dominant Pfam architecture(s) | UNKNOWN |
| Sequences matching dominant architecture (%) | 0.0 |
| Average overlap percent | 0.0 |
| Pfam Overlap Label | NONE |
Seed Sequences
| Protein ID | Range | Length | Seed Sequence |
|---|---|---|---|
| A0A0R3PX29 | 185-278 | 94 | AQESFTLEPLEAGALDHQQERRRRKRRLIIDDQKNISGDEMKANMADYSDTLQSLDLAPPTRRLMRMKESGVVEKLFHLPGCAFL... |
Representative AlphaFold Structure
| AlphaFold ID | Sequence Range | HMM Coverage | Avg pLDDT | AlphaFold 3D Structure |
|---|---|---|---|---|
| AF-O93310-F1 | 292-392 | 100.00 | 81.11 | View in AlphaFoldDB ↗ |