DPCfam | MC93793
Metacluster Properties and Pfam Annotations
| Number of UniRef50 seed sequences | 121 |
|---|---|
| Mean domain length (aa) | 185 ± 21 aa |
| Residues in low-complexity regions (%) | 7.31 |
| Residues in coiled-coil regions (%) | 0.0 |
| Predicted disordered residues (%) | 14.19 |
| Average transmembrane regions | 1.09 |
| Dominant Pfam architecture(s) | PF01595 |
| Sequences matching dominant architecture (%) | 92.0 |
| Average overlap percent | 19.29 |
| Pfam Overlap Label | Shifted |
Seed Sequences
| Protein ID | Range | Length | Seed Sequence |
|---|---|---|---|
| A0A1I8GF82 | 504-672 | 169 | IRLYGRGLQALDRLAFANTHHDNGLCLDAKLPTSFRLKPGETGLTAVAMVTVPSDLVPMPSGGYLLLCLHGNWTTKVAKKSDSTE... |
Representative AlphaFold Structure
| AlphaFold ID | Sequence Range | HMM Coverage | Avg pLDDT | AlphaFold 3D Structure |
|---|---|---|---|---|
| AF-A2ATX7-F1 | 46-257 | 99.47 | 75.58 | View in AlphaFoldDB ↗ |