DPCfam | MC93607
Metacluster Properties and Pfam Annotations
| Number of UniRef50 seed sequences | 61 |
|---|---|
| Mean domain length (aa) | 315 ± 45 aa |
| Residues in low-complexity regions (%) | 3.32 |
| Residues in coiled-coil regions (%) | 0.0 |
| Predicted disordered residues (%) | 19.28 |
| Average transmembrane regions | 0.02 |
| Dominant Pfam architecture(s) | PF00188 |
| Sequences matching dominant architecture (%) | 74.58 |
| Average overlap percent | 34.01 |
| Pfam Overlap Label | Extended |
Seed Sequences
| Protein ID | Range | Length | Seed Sequence |
|---|---|---|---|
| A0A0N5DWE8 | 17-345 | 329 | SGLRGNPQPLSDSSRKQILDGLNAFRGSLGSSNMQCLSSWSSEMEEEAQKIADECILPTHHEKYGIGSVYTSDEVMSVIKYVELV... |
Representative AlphaFold Structure
| AlphaFold ID | Sequence Range | HMM Coverage | Avg pLDDT | AlphaFold 3D Structure |
|---|---|---|---|---|
| AF-A0A077YV57-F1 | 289-643 | 100.00 | 71.41 | View in AlphaFoldDB ↗ |