DPCfam | MC93599
Metacluster Properties and Pfam Annotations
| Number of UniRef50 seed sequences | 101 |
|---|---|
| Mean domain length (aa) | 343 ± 33 aa |
| Residues in low-complexity regions (%) | 4.05 |
| Residues in coiled-coil regions (%) | 0.0 |
| Predicted disordered residues (%) | 24.97 |
| Average transmembrane regions | 0 |
| Dominant Pfam architecture(s) | PF07285 |
| Sequences matching dominant architecture (%) | 12.33 |
| Average overlap percent | 49.89 |
| Pfam Overlap Label | Extended |
Seed Sequences
| Protein ID | Range | Length | Seed Sequence |
|---|---|---|---|
| G8SFZ7 | 27-396 | 370 | GVDRAVSRPDDFSIAIYRTGATGPAHLYLANIFRETEGATPAERRERLAKLVRIMAAPPPQDDWETVRPKLRPVLRPVTFGSAGP... |
Representative AlphaFold Structure
| AlphaFold ID | Sequence Range | HMM Coverage | Avg pLDDT | AlphaFold 3D Structure |
|---|---|---|---|---|
| AF-K0EM76-F1 | 45-391 | 99.42 | 90.03 | View in AlphaFoldDB ↗ |