DPCfam | MC93548
Metacluster Properties and Pfam Annotations
| Number of UniRef50 seed sequences | 51 |
|---|---|
| Mean domain length (aa) | 354 ± 36 aa |
| Residues in low-complexity regions (%) | 1.62 |
| Residues in coiled-coil regions (%) | 0.33 |
| Predicted disordered residues (%) | 15.3 |
| Average transmembrane regions | 0 |
| Dominant Pfam architecture(s) | PF04411 |
| Sequences matching dominant architecture (%) | 48.48 |
| Average overlap percent | 30.22 |
| Pfam Overlap Label | Extended |
Seed Sequences
| Protein ID | Range | Length | Seed Sequence |
|---|---|---|---|
| B1KQE1 | 512-860 | 349 | EKLGVKPSSTFPNSMTFVQNIDYQAVHSGYKRIREQTNLTDEDLLLSLEKVEDIGLINMPLLYERWCLLQMIKVLVQNYHYQPTD... |
Representative AlphaFold Structure
| AlphaFold ID | Sequence Range | HMM Coverage | Avg pLDDT | AlphaFold 3D Structure |
|---|---|---|---|---|
| AF-Q52NW7-F1 | 277-634 | 98.25 | 88.12 | View in AlphaFoldDB ↗ |