DPCfam | MC93440
Metacluster Properties and Pfam Annotations
| Number of UniRef50 seed sequences | 51 |
|---|---|
| Mean domain length (aa) | 302 ± 31 aa |
| Residues in low-complexity regions (%) | 1.22 |
| Residues in coiled-coil regions (%) | 0.0 |
| Predicted disordered residues (%) | 25.89 |
| Average transmembrane regions | 0 |
| Dominant Pfam architecture(s) | PF01935 |
| Sequences matching dominant architecture (%) | 91.89 |
| Average overlap percent | 30.02 |
| Pfam Overlap Label | Extended |
Seed Sequences
| Protein ID | Range | Length | Seed Sequence |
|---|---|---|---|
| B8FH20 | 35-312 | 278 | AQNYDKMRFVGYVLDIGFDQATIITCDPFKQAVGGVPRGSFLIMAPANFNGMPPHFSLLRVSATAPTPLSREVQQTYFELHKKSM... |
Representative AlphaFold Structure
| AlphaFold ID | Sequence Range | HMM Coverage | Avg pLDDT | AlphaFold 3D Structure |
|---|---|---|---|---|
| AF-Q58960-F1 | 135-214 | 29.04 | 95.98 | View in AlphaFoldDB ↗ |