DPCfam | MC93267
Metacluster Properties and Pfam Annotations
| Number of UniRef50 seed sequences | 61 |
|---|---|
| Mean domain length (aa) | 222 ± 43 aa |
| Residues in low-complexity regions (%) | 5.88 |
| Residues in coiled-coil regions (%) | 0.33 |
| Predicted disordered residues (%) | 21.93 |
| Average transmembrane regions | 0.11 |
| Dominant Pfam architecture(s) | PF14656 |
| Sequences matching dominant architecture (%) | 95.45 |
| Average overlap percent | 51.34 |
| Pfam Overlap Label | Reduced |
Seed Sequences
| Protein ID | Range | Length | Seed Sequence |
|---|---|---|---|
| Q7ZYZ0 | 746-956 | 211 | VSHLKTLLSTLSSIKGAVDESWDGQCVSPWWQQVRTACVQSESSAAALLAALVAHHVAKNAITKLAESKFQEGWECVSLELEQWV... |
Representative AlphaFold Structure
| AlphaFold ID | Sequence Range | HMM Coverage | Avg pLDDT | AlphaFold 3D Structure |
|---|---|---|---|---|
| AF-Q9H2M9-F1 | 774-1027 | 99.60 | 76.58 | View in AlphaFoldDB ↗ |