DPCfam | MC93024
Metacluster Properties and Pfam Annotations
| Number of UniRef50 seed sequences | 71 |
|---|---|
| Mean domain length (aa) | 51 ± 8 aa |
| Residues in low-complexity regions (%) | 0.51 |
| Residues in coiled-coil regions (%) | 0.0 |
| Predicted disordered residues (%) | 27.12 |
| Average transmembrane regions | 0 |
| Dominant Pfam architecture(s) | PF07714 |
| Sequences matching dominant architecture (%) | 89.86 |
| Average overlap percent | 15.83 |
| Pfam Overlap Label | Shifted |
Seed Sequences
| Protein ID | Range | Length | Seed Sequence |
|---|---|---|---|
| A0A167UXT5 | 41-99 | 59 | LDLTGRVSREGEFPSGLGGFADVWKGIWTDARGSHAVAIKVLRAPLDDPAKQSKMQKRL... |
Representative AlphaFold Structure
| AlphaFold ID | Sequence Range | HMM Coverage | Avg pLDDT | AlphaFold 3D Structure |
|---|---|---|---|---|
| AF-A0A1D6FD19-F1 | 18-51 | 70.59 | 77.19 | View in AlphaFoldDB ↗ |