DPCfam | MC9234
Metacluster Properties and Pfam Annotations
| Number of UniRef50 seed sequences | 51 |
|---|---|
| Mean domain length (aa) | 495 ± 20 aa |
| Residues in low-complexity regions (%) | 9.5 |
| Residues in coiled-coil regions (%) | 0.06 |
| Predicted disordered residues (%) | 5.25 |
| Average transmembrane regions | 10.06 |
| Dominant Pfam architecture(s) | PF04932 |
| Sequences matching dominant architecture (%) | 97.96 |
| Average overlap percent | 55.3 |
| Pfam Overlap Label | Extended |
Seed Sequences
| Protein ID | Range | Length | Seed Sequence |
|---|---|---|---|
| A0A1F3MGE4 | 40-534 | 495 | LWIWSGFSFQIAFRFFKFSGPIRGFFHFIHYLYSLTVDNLAEKLGLFFRNPAAVVLVSIYLLHIIGLLHTQNFDYALKDLRVKLP... |
Representative AlphaFold Structure
| AlphaFold ID | Sequence Range | HMM Coverage | Avg pLDDT | AlphaFold 3D Structure |
|---|---|---|---|---|
| AF-P44067-F1 | 43-233 | 39.56 | 92.12 | View in AlphaFoldDB ↗ |