DPCfam | MC92318
Metacluster Properties and Pfam Annotations
| Number of UniRef50 seed sequences | 51 |
|---|---|
| Mean domain length (aa) | 125 ± 9 aa |
| Residues in low-complexity regions (%) | 2.08 |
| Residues in coiled-coil regions (%) | 0.0 |
| Predicted disordered residues (%) | 26.83 |
| Average transmembrane regions | 0 |
| Dominant Pfam architecture(s) | PF05834 |
| Sequences matching dominant architecture (%) | 98.0 |
| Average overlap percent | 40.48 |
| Pfam Overlap Label | Reduced |
Seed Sequences
| Protein ID | Range | Length | Seed Sequence |
|---|---|---|---|
| V4WE19 | 183-311 | 129 | RAYGRVSRHLLHEELLRRCVESGVSYLSSKVESITESTSGHRLVACEHDMIVPCRLATVASGAASGKLLEYEVGGPKVSVQTAYG... |
Representative AlphaFold Structure
| AlphaFold ID | Sequence Range | HMM Coverage | Avg pLDDT | AlphaFold 3D Structure |
|---|---|---|---|---|
| AF-Q38933-F1 | 167-288 | 100.00 | 97.05 | View in AlphaFoldDB ↗ |