DPCfam | MC92286
Metacluster Properties and Pfam Annotations
| Number of UniRef50 seed sequences | 51 |
|---|---|
| Mean domain length (aa) | 89 ± 8 aa |
| Residues in low-complexity regions (%) | 0.15 |
| Residues in coiled-coil regions (%) | 0.0 |
| Predicted disordered residues (%) | 31.2 |
| Average transmembrane regions | 0 |
| Dominant Pfam architecture(s) | UNKNOWN |
| Sequences matching dominant architecture (%) | 0.0 |
| Average overlap percent | 0.0 |
| Pfam Overlap Label | NONE |
Seed Sequences
| Protein ID | Range | Length | Seed Sequence |
|---|---|---|---|
| G3WHW9 | 332-419 | 88 | FLERYRLVRTGIKPMDDHCLPSTLLDEFGELTNAFRQATFLVYLKCVKACEDYQIPLTEKTLMKALLYHGDKIVLEKDHVLKLRQ... |
Representative AlphaFold Structure
| AlphaFold ID | Sequence Range | HMM Coverage | Avg pLDDT | AlphaFold 3D Structure |
|---|---|---|---|---|
| AF-Q95LL8-F1 | 351-440 | 100.00 | 76.87 | View in AlphaFoldDB ↗ |