DPCfam | MC92258
Metacluster Properties and Pfam Annotations
| Number of UniRef50 seed sequences | 191 |
|---|---|
| Mean domain length (aa) | 73 ± 8 aa |
| Residues in low-complexity regions (%) | 2.63 |
| Residues in coiled-coil regions (%) | 0.0 |
| Predicted disordered residues (%) | 1.19 |
| Average transmembrane regions | 1.19 |
| Dominant Pfam architecture(s) | PF01694 |
| Sequences matching dominant architecture (%) | 95.18 |
| Average overlap percent | 48.8 |
| Pfam Overlap Label | Reduced |
Seed Sequences
| Protein ID | Range | Length | Seed Sequence |
|---|---|---|---|
| A0A0L8FZT2 | 147-214 | 68 | CAVGFSAVIFAIKVVLNYMNPQEQHAYGGFLIPYKYIHWLEVVMIQLIVPQASFLGHISGIIVGLIYC... |
Representative AlphaFold Structure
| AlphaFold ID | Sequence Range | HMM Coverage | Avg pLDDT | AlphaFold 3D Structure |
|---|---|---|---|---|
| AF-A0A0N4UBC4-F1 | 142-213 | 98.63 | 89.66 | View in AlphaFoldDB ↗ |