DPCfam | MC91824
Metacluster Properties and Pfam Annotations
| Number of UniRef50 seed sequences | 91 |
|---|---|
| Mean domain length (aa) | 68 ± 5 aa |
| Residues in low-complexity regions (%) | 0.78 |
| Residues in coiled-coil regions (%) | 0.0 |
| Predicted disordered residues (%) | 29.14 |
| Average transmembrane regions | 0 |
| Dominant Pfam architecture(s) | PF08450 |
| Sequences matching dominant architecture (%) | 12.33 |
| Average overlap percent | 15.71 |
| Pfam Overlap Label | Shifted |
Seed Sequences
| Protein ID | Range | Length | Seed Sequence |
|---|---|---|---|
| A0A0Q0ZUC6 | 37-97 | 61 | LKTPESVIYDPVDSLLYVSNIVDDPLAADGNGFISKIGLDGKIIQLEWITGLNAPKGMGIF... |
Representative AlphaFold Structure
| AlphaFold ID | Sequence Range | HMM Coverage | Avg pLDDT | AlphaFold 3D Structure |
|---|---|---|---|---|
| AF-Q0P9L1-F1 | 26-86 | 89.71 | 98.30 | View in AlphaFoldDB ↗ |