DPCfam | MC91643
Metacluster Properties and Pfam Annotations
| Number of UniRef50 seed sequences | 101 |
|---|---|
| Mean domain length (aa) | 60 ± 8 aa |
| Residues in low-complexity regions (%) | 9.67 |
| Residues in coiled-coil regions (%) | 0.0 |
| Predicted disordered residues (%) | 15.01 |
| Average transmembrane regions | 0 |
| Dominant Pfam architecture(s) | PF00370 |
| Sequences matching dominant architecture (%) | 79.55 |
| Average overlap percent | 36.83 |
| Pfam Overlap Label | Reduced |
Seed Sequences
| Protein ID | Range | Length | Seed Sequence |
|---|---|---|---|
| UPI0005BB45A7 | 195-254 | 60 | LVSSFLASLFLGDYAPTDWSDGSGMNLLNIRTKDWEDVLLETCASGLREKLGKPVSSCSN... |
Representative AlphaFold Structure
| AlphaFold ID | Sequence Range | HMM Coverage | Avg pLDDT | AlphaFold 3D Structure |
|---|---|---|---|---|
| AF-Q3MIF4-F1 | 191-247 | 96.72 | 98.79 | View in AlphaFoldDB ↗ |