DPCfam | MC91623
Metacluster Properties and Pfam Annotations
| Number of UniRef50 seed sequences | 261 |
|---|---|
| Mean domain length (aa) | 85 ± 7 aa |
| Residues in low-complexity regions (%) | 10.44 |
| Residues in coiled-coil regions (%) | 0.0 |
| Predicted disordered residues (%) | 2.74 |
| Average transmembrane regions | 2.14 |
| Dominant Pfam architecture(s) | PF01080 |
| Sequences matching dominant architecture (%) | 94.81 |
| Average overlap percent | 43.8 |
| Pfam Overlap Label | Reduced |
Seed Sequences
| Protein ID | Range | Length | Seed Sequence |
|---|---|---|---|
| A0A0S4J6N6 | 284-371 | 88 | FSTADPSRFFKLGLGDFIFYSLLVGRAATWSFVAWVACYIAVMLGLVGTLCSLLFLRGKVPALPALPISIFLGVGTFFISKYLIS... |
Representative AlphaFold Structure
| AlphaFold ID | Sequence Range | HMM Coverage | Avg pLDDT | AlphaFold 3D Structure |
|---|---|---|---|---|
| AF-A0A077ZC08-F1 | 655-734 | 95.24 | 83.98 | View in AlphaFoldDB ↗ |