DPCfam | MC91530
Metacluster Properties and Pfam Annotations
| Number of UniRef50 seed sequences | 71 |
|---|---|
| Mean domain length (aa) | 280 ± 26 aa |
| Residues in low-complexity regions (%) | 8.68 |
| Residues in coiled-coil regions (%) | 0.26 |
| Predicted disordered residues (%) | 7.47 |
| Average transmembrane regions | 5.12 |
| Dominant Pfam architecture(s) | PF00664 |
| Sequences matching dominant architecture (%) | 13.24 |
| Average overlap percent | 3.86 |
| Pfam Overlap Label | Shifted |
Seed Sequences
| Protein ID | Range | Length | Seed Sequence |
|---|---|---|---|
| W9C9J0 | 598-871 | 274 | YSDNDGDADPKELKQFSDRLPKTLALTFLVIDLIFVLIRLLPIEAAQPPLPQIIARILIGMQLGLLFGVSSPVKRFNIGCCAGTS... |
Representative AlphaFold Structure
| AlphaFold ID | Sequence Range | HMM Coverage | Avg pLDDT | AlphaFold 3D Structure |
|---|---|---|---|---|
| AF-C0NUN2-F1 | 36-305 | 96.42 | 83.08 | View in AlphaFoldDB ↗ |