DPCfam | MC91506
Metacluster Properties and Pfam Annotations
| Number of UniRef50 seed sequences | 51 |
|---|---|
| Mean domain length (aa) | 139 ± 21 aa |
| Residues in low-complexity regions (%) | 21.81 |
| Residues in coiled-coil regions (%) | 0.0 |
| Predicted disordered residues (%) | 66.85 |
| Average transmembrane regions | 0 |
| Dominant Pfam architecture(s) | PF02205 |
| Sequences matching dominant architecture (%) | 61.54 |
| Average overlap percent | 17.8 |
| Pfam Overlap Label | Extended |
Seed Sequences
| Protein ID | Range | Length | Seed Sequence |
|---|---|---|---|
| UPI0004571435 | 424-537 | 114 | SYHCTSNVKPFNMVHPTDDSSEHIVELKSETLLKTVGFTTVFVGNSGQLKQTFEEDEKENGFLPLPVDEVSSIDVDSLVPTHDER... |
Representative AlphaFold Structure
| AlphaFold ID | Sequence Range | HMM Coverage | Avg pLDDT | AlphaFold 3D Structure |
|---|---|---|---|---|
| AF-B1AK53-F1 | 641-781 | 95.95 | 51.84 | View in AlphaFoldDB ↗ |