DPCfam | MC91442
Metacluster Properties and Pfam Annotations
| Number of UniRef50 seed sequences | 61 |
|---|---|
| Mean domain length (aa) | 93 ± 13 aa |
| Residues in low-complexity regions (%) | 8.29 |
| Residues in coiled-coil regions (%) | 0.0 |
| Predicted disordered residues (%) | 31.08 |
| Average transmembrane regions | 0 |
| Dominant Pfam architecture(s) | PF12796 |
| Sequences matching dominant architecture (%) | 38.46 |
| Average overlap percent | 13.06 |
| Pfam Overlap Label | Shifted |
Seed Sequences
| Protein ID | Range | Length | Seed Sequence |
|---|---|---|---|
| T1I5Q9 | 630-719 | 90 | DGIKAEITALKYGFNDISDLLNKIRSNYTRDLYIRQLVPNCQQLPRFNVQIFGHSGVGKSTLLETMRTGYFSGFFKRTKSNHFNN... |
Representative AlphaFold Structure
| AlphaFold ID | Sequence Range | HMM Coverage | Avg pLDDT | AlphaFold 3D Structure |
|---|---|---|---|---|
| AF-P53355-F1 | 642-730 | 96.74 | 78.25 | View in AlphaFoldDB ↗ |