DPCfam | MC91383
Metacluster Properties and Pfam Annotations
| Number of UniRef50 seed sequences | 61 |
|---|---|
| Mean domain length (aa) | 191 ± 20 aa |
| Residues in low-complexity regions (%) | 4.84 |
| Residues in coiled-coil regions (%) | 0.0 |
| Predicted disordered residues (%) | 8.93 |
| Average transmembrane regions | 2.05 |
| Dominant Pfam architecture(s) | UNKNOWN |
| Sequences matching dominant architecture (%) | 0.0 |
| Average overlap percent | 0.0 |
| Pfam Overlap Label | NONE |
Seed Sequences
| Protein ID | Range | Length | Seed Sequence |
|---|---|---|---|
| G4UPR1 | 661-873 | 213 | QKELDRYGTSMKSWVFEEKGIMVKCKTYVALTMVLCTVLVGGGIAVGVTVGSSITAVDPFNITTYCWVLAAFVLLIAKSIRVHEW... |
Representative AlphaFold Structure
| AlphaFold ID | Sequence Range | HMM Coverage | Avg pLDDT | AlphaFold 3D Structure |
|---|---|---|---|---|
| AF-A0A175VN52-F1 | 557-729 | 86.93 | 88.28 | View in AlphaFoldDB ↗ |