DPCfam | MC90913
Metacluster Properties and Pfam Annotations
| Number of UniRef50 seed sequences | 81 |
|---|---|
| Mean domain length (aa) | 235 ± 20 aa |
| Residues in low-complexity regions (%) | 2.03 |
| Residues in coiled-coil regions (%) | 0.0 |
| Predicted disordered residues (%) | 17.58 |
| Average transmembrane regions | 0 |
| Dominant Pfam architecture(s) | PF15067 |
| Sequences matching dominant architecture (%) | 92.0 |
| Average overlap percent | 95.58 |
| Pfam Overlap Label | Equivalent |
Seed Sequences
| Protein ID | Range | Length | Seed Sequence |
|---|---|---|---|
| A7S8W9 | 54-296 | 243 | LQIRTQKGEGGFLKNLYRPLLEGIDPTFQFICIEESEDVKYPLTVWGENLPRSSDNFVCTSLSVVLFLRETFGRLSALSMQKNLG... |
Representative AlphaFold Structure
| AlphaFold ID | Sequence Range | HMM Coverage | Avg pLDDT | AlphaFold 3D Structure |
|---|---|---|---|---|
| AF-F1M0D2-F1 | 47-279 | 99.58 | 89.67 | View in AlphaFoldDB ↗ |