DPCfam | MC90897
Metacluster Properties and Pfam Annotations
| Number of UniRef50 seed sequences | 71 |
|---|---|
| Mean domain length (aa) | 66 ± 6 aa |
| Residues in low-complexity regions (%) | 0.34 |
| Residues in coiled-coil regions (%) | 0.0 |
| Predicted disordered residues (%) | 33.3 |
| Average transmembrane regions | 0 |
| Dominant Pfam architecture(s) | PF00168 |
| Sequences matching dominant architecture (%) | 3.77 |
| Average overlap percent | 40.51 |
| Pfam Overlap Label | Shifted |
Seed Sequences
| Protein ID | Range | Length | Seed Sequence |
|---|---|---|---|
| F6SH36 | 1-57 | 57 | EIQLSKSDVVLSFTLEIVIMEVQGLKSVAPNRIVYCTMEVEGGEKLQTDQAEASRPQ... |
Representative AlphaFold Structure
| AlphaFold ID | Sequence Range | HMM Coverage | Avg pLDDT | AlphaFold 3D Structure |
|---|---|---|---|---|
| AF-F1RCD5-F1 | 341-407 | 98.53 | 77.37 | View in AlphaFoldDB ↗ |