DPCfam | MC9086
Metacluster Properties and Pfam Annotations
| Number of UniRef50 seed sequences | 151 |
|---|---|
| Mean domain length (aa) | 177 ± 18 aa |
| Residues in low-complexity regions (%) | 4.01 |
| Residues in coiled-coil regions (%) | 0.0 |
| Predicted disordered residues (%) | 10.52 |
| Average transmembrane regions | 0.07 |
| Dominant Pfam architecture(s) | PF14776 |
| Sequences matching dominant architecture (%) | 0.88 |
| Average overlap percent | 32.01 |
| Pfam Overlap Label | Reduced |
Seed Sequences
| Protein ID | Range | Length | Seed Sequence |
|---|---|---|---|
| B3RZ40 | 1179-1347 | 169 | DIDPDDMRNETMYRLIELFMQYLRRSSSTNSKIGNNNDNSQYHMKIFLCIQRLMGYNHVTQIFNLSSSKLRSSLIYKAFLVEAPL... |
Representative AlphaFold Structure
| AlphaFold ID | Sequence Range | HMM Coverage | Avg pLDDT | AlphaFold 3D Structure |
|---|---|---|---|---|
| AF-P42173-F1 | 6-181 | 98.33 | 86.44 | View in AlphaFoldDB ↗ |