DPCfam | MC90712
Metacluster Properties and Pfam Annotations
| Number of UniRef50 seed sequences | 101 |
|---|---|
| Mean domain length (aa) | 89 ± 10 aa |
| Residues in low-complexity regions (%) | 0.61 |
| Residues in coiled-coil regions (%) | 0.0 |
| Predicted disordered residues (%) | 8.54 |
| Average transmembrane regions | 0 |
| Dominant Pfam architecture(s) | PF02889 |
| Sequences matching dominant architecture (%) | 100.0 |
| Average overlap percent | 30.91 |
| Pfam Overlap Label | Reduced |
Seed Sequences
| Protein ID | Range | Length | Seed Sequence |
|---|---|---|---|
| W4XJ32 | 1212-1290 | 79 | IHGNSEAFWILVEDVDSEIILHHEYFLLKSKFAQDEHIVKFSVPVFEPLPPQYFIRVVSDRWIVSETQLPVSFRHLILP... |
Representative AlphaFold Structure
| AlphaFold ID | Sequence Range | HMM Coverage | Avg pLDDT | AlphaFold 3D Structure |
|---|---|---|---|---|
| AF-O75643-F1 | 1214-1303 | 100.00 | 90.29 | View in AlphaFoldDB ↗ |