DPCfam | MC90700
Metacluster Properties and Pfam Annotations
| Number of UniRef50 seed sequences | 26981 |
|---|---|
| Mean domain length (aa) | 267 ± 47 aa |
| Residues in low-complexity regions (%) | 5.96 |
| Residues in coiled-coil regions (%) | 6.05 |
| Predicted disordered residues (%) | 4.46 |
| Average transmembrane regions | 5.95 |
| Dominant Pfam architecture(s) | PF00001 |
| Sequences matching dominant architecture (%) | 68.53 |
| Average overlap percent | 86.82 |
| Pfam Overlap Label | Equivalent |
Seed Sequences
| Protein ID | Range | Length | Seed Sequence |
|---|---|---|---|
| UPI00064B89D6 | 13-288 | 276 | VGILGNSVLLGLYSLPLINKLMLKPTDCILSHLVVANNLVLLKGIPHIMATFGSPSFLDDSVCKLVFYLHRVARGVSLAITCFLS... |
Representative AlphaFold Structure
| AlphaFold ID | Sequence Range | HMM Coverage | Avg pLDDT | AlphaFold 3D Structure |
|---|---|---|---|---|
| AF-F1R2F3-F1 | 84-361 | 100.00 | 82.22 | View in AlphaFoldDB ↗ |