DPCfam | MC90619
Metacluster Properties and Pfam Annotations
| Number of UniRef50 seed sequences | 51 |
|---|---|
| Mean domain length (aa) | 109 ± 11 aa |
| Residues in low-complexity regions (%) | 4.53 |
| Residues in coiled-coil regions (%) | 0.0 |
| Predicted disordered residues (%) | 15.69 |
| Average transmembrane regions | 0 |
| Dominant Pfam architecture(s) | PF18569 |
| Sequences matching dominant architecture (%) | 100.0 |
| Average overlap percent | 80.63 |
| Pfam Overlap Label | Equivalent |
Seed Sequences
| Protein ID | Range | Length | Seed Sequence |
|---|---|---|---|
| V5IA46 | 154-257 | 104 | DIVINANPSNPPYSLQIIQKLLQDTLALTFSTYLHSTVSSLSEEAKKLDSTIVNFAPKSNVLKLNIRLIWKTIDSNTELLVSHIP... |
Representative AlphaFold Structure
| AlphaFold ID | Sequence Range | HMM Coverage | Avg pLDDT | AlphaFold 3D Structure |
|---|---|---|---|---|
| AF-Q13155-F1 | 119-221 | 96.33 | 89.92 | View in AlphaFoldDB ↗ |