DPCfam | MC90610
Metacluster Properties and Pfam Annotations
| Number of UniRef50 seed sequences | 351 |
|---|---|
| Mean domain length (aa) | 219 ± 35 aa |
| Residues in low-complexity regions (%) | 2.56 |
| Residues in coiled-coil regions (%) | 0.03 |
| Predicted disordered residues (%) | 17.67 |
| Average transmembrane regions | 0 |
| Dominant Pfam architecture(s) | PF07574- PF08746 |
| Sequences matching dominant architecture (%) | 53.7 |
| Average overlap percent | 94.25 |
| Pfam Overlap Label | Equivalent |
Seed Sequences
| Protein ID | Range | Length | Seed Sequence |
|---|---|---|---|
| A0A1E4TK05 | 22-243 | 222 | INSIILRLNSDSSFDQFSQSVRNTLNQFGFELVSTIDQLSSLKCYTITNTLSDNASKRSNNKYMDTIILRAMLSEVFEPSGSSLP... |
Representative AlphaFold Structure
| AlphaFold ID | Sequence Range | HMM Coverage | Avg pLDDT | AlphaFold 3D Structure |
|---|---|---|---|---|
| AF-C0NZ17-F1 | 14-275 | 100.00 | 87.34 | View in AlphaFoldDB ↗ |