DPCfam | MC90561
Metacluster Properties and Pfam Annotations
| Number of UniRef50 seed sequences | 71 |
|---|---|
| Mean domain length (aa) | 146 ± 28 aa |
| Residues in low-complexity regions (%) | 3.88 |
| Residues in coiled-coil regions (%) | 0.25 |
| Predicted disordered residues (%) | 37.41 |
| Average transmembrane regions | 0.98 |
| Dominant Pfam architecture(s) | PF00226 |
| Sequences matching dominant architecture (%) | 94.44 |
| Average overlap percent | 15.95 |
| Pfam Overlap Label | Shifted |
Seed Sequences
| Protein ID | Range | Length | Seed Sequence |
|---|---|---|---|
| UPI00076FBAC9 | 54-203 | 150 | LHPDVGDNGSHTKFVKVNEAYRVLSKDYTRQQYDNRLRHGYTFVQQPKGEQTYYEAEPVYRDPVYQAAHNPRRTEFHDDYYGVKG... |
Representative AlphaFold Structure
| AlphaFold ID | Sequence Range | HMM Coverage | Avg pLDDT | AlphaFold 3D Structure |
|---|---|---|---|---|
| AF-Q9D844-F1 | 64-220 | 99.40 | 83.04 | View in AlphaFoldDB ↗ |