DPCfam | MC9016
Metacluster Properties and Pfam Annotations
| Number of UniRef50 seed sequences | 81 |
|---|---|
| Mean domain length (aa) | 106 ± 14 aa |
| Residues in low-complexity regions (%) | 0.47 |
| Residues in coiled-coil regions (%) | 0.0 |
| Predicted disordered residues (%) | 33.79 |
| Average transmembrane regions | 0.03 |
| Dominant Pfam architecture(s) | PF10278 |
| Sequences matching dominant architecture (%) | 89.19 |
| Average overlap percent | 68.92 |
| Pfam Overlap Label | Reduced |
Seed Sequences
| Protein ID | Range | Length | Seed Sequence |
|---|---|---|---|
| A0A183X4B9 | 37-135 | 99 | GQNWAVAPCEPFYLMGTEPPAPDAALTGSKNLIEHYGLENAYQKFCGKRLKEELSAFLPHLSGNIDVPASVDGSGLMVSFRRVSL... |
Representative AlphaFold Structure
| AlphaFold ID | Sequence Range | HMM Coverage | Avg pLDDT | AlphaFold 3D Structure |
|---|---|---|---|---|
| AF-A0A0N4U7U4-F1 | 33-137 | 99.06 | 80.30 | View in AlphaFoldDB ↗ |