DPCfam | MC90019
Metacluster Properties and Pfam Annotations
| Number of UniRef50 seed sequences | 51 |
|---|---|
| Mean domain length (aa) | 208 ± 13 aa |
| Residues in low-complexity regions (%) | 9.03 |
| Residues in coiled-coil regions (%) | 26.73 |
| Predicted disordered residues (%) | 37.01 |
| Average transmembrane regions | 0 |
| Dominant Pfam architecture(s) | PF15449 |
| Sequences matching dominant architecture (%) | 100.0 |
| Average overlap percent | 50.57 |
| Pfam Overlap Label | Reduced |
Seed Sequences
| Protein ID | Range | Length | Seed Sequence |
|---|---|---|---|
| A6NGG8 | 171-365 | 195 | EGKVDFPEPLVKAHQQAYTYLHSSLSKYEAILCIIHQATQTRELLQPMVSFLLLCFEEISQLLGEISKDGEVLLQEVREDLAWPL... |
Representative AlphaFold Structure
| AlphaFold ID | Sequence Range | HMM Coverage | Avg pLDDT | AlphaFold 3D Structure |
|---|---|---|---|---|
| AF-A6NGG8-F1 | 164-363 | 92.17 | 78.37 | View in AlphaFoldDB ↗ |