DPCfam | MC8983
Metacluster Properties and Pfam Annotations
| Number of UniRef50 seed sequences | 61 |
|---|---|
| Mean domain length (aa) | 125 ± 14 aa |
| Residues in low-complexity regions (%) | 13.46 |
| Residues in coiled-coil regions (%) | 18.55 |
| Predicted disordered residues (%) | 41.3 |
| Average transmembrane regions | 0.03 |
| Dominant Pfam architecture(s) | PF00069 |
| Sequences matching dominant architecture (%) | 2.08 |
| Average overlap percent | 24.39 |
| Pfam Overlap Label | Reduced |
Seed Sequences
| Protein ID | Range | Length | Seed Sequence |
|---|---|---|---|
| A0A0V0YG01 | 1818-1936 | 119 | VLRQQRIKPHWMFALDNLIRSCVQCVVEMLLPDAVSNLSVQDSDGSSSYSSVESAKSPIVPSFGYNDFGFTSSLAKQLRKELKDY... |
Representative AlphaFold Structure
| AlphaFold ID | Sequence Range | HMM Coverage | Avg pLDDT | AlphaFold 3D Structure |
|---|---|---|---|---|
| AF-A0A2R8Q7G0-F1 | 1105-1240 | 98.44 | 58.65 | View in AlphaFoldDB ↗ |