DPCfam | MC89740
Metacluster Properties and Pfam Annotations
| Number of UniRef50 seed sequences | 121 |
|---|---|
| Mean domain length (aa) | 533 ± 91 aa |
| Residues in low-complexity regions (%) | 6.36 |
| Residues in coiled-coil regions (%) | 0.0 |
| Predicted disordered residues (%) | 19.31 |
| Average transmembrane regions | 0.1 |
| Dominant Pfam architecture(s) | PF14228- PF14225 |
| Sequences matching dominant architecture (%) | 41.49 |
| Average overlap percent | 91.14 |
| Pfam Overlap Label | Equivalent |
Seed Sequences
| Protein ID | Range | Length | Seed Sequence |
|---|---|---|---|
| UPI0005EF3C85 | 1802-2177 | 376 | KALIEFLVTRKCRPLWSCEEITPRLTIIKSAEQLESFLRNVVRIFHGSLRGSHLEQRWAQVALQLALSCSSRHYAGRSFQMFRAL... |
Representative AlphaFold Structure
| AlphaFold ID | Sequence Range | HMM Coverage | Avg pLDDT | AlphaFold 3D Structure |
|---|---|---|---|---|
| AF-A0A3P7DEH2-F1 | 1015-1552 | 98.33 | 76.77 | View in AlphaFoldDB ↗ |