DPCfam | MC89725
Metacluster Properties and Pfam Annotations
| Number of UniRef50 seed sequences | 851 |
|---|---|
| Mean domain length (aa) | 241 ± 32 aa |
| Residues in low-complexity regions (%) | 3.09 |
| Residues in coiled-coil regions (%) | 0.0 |
| Predicted disordered residues (%) | 26.66 |
| Average transmembrane regions | 0 |
| Dominant Pfam architecture(s) | PF09234 |
| Sequences matching dominant architecture (%) | 91.2 |
| Average overlap percent | 89.33 |
| Pfam Overlap Label | Equivalent |
Seed Sequences
| Protein ID | Range | Length | Seed Sequence |
|---|---|---|---|
| UPI0002FD76DD | 48-316 | 269 | VLEADSLSKLGGLPNLPDGVDWPRQGVSNTPLHFLAQIELAHLPPTPLAPRTAALPARGFLFFFADMEEEMLWGWGDRGADSDAT... |
Representative AlphaFold Structure
| AlphaFold ID | Sequence Range | HMM Coverage | Avg pLDDT | AlphaFold 3D Structure |
|---|---|---|---|---|
| AF-P96719-F1 | 23-259 | 98.62 | 95.99 | View in AlphaFoldDB ↗ |