DPCfam | MC89439
Metacluster Properties and Pfam Annotations
| Number of UniRef50 seed sequences | 131 |
|---|---|
| Mean domain length (aa) | 71 ± 7 aa |
| Residues in low-complexity regions (%) | 7.66 |
| Residues in coiled-coil regions (%) | 0.0 |
| Predicted disordered residues (%) | 1.26 |
| Average transmembrane regions | 1.85 |
| Dominant Pfam architecture(s) | PF02665 |
| Sequences matching dominant architecture (%) | 99.07 |
| Average overlap percent | 36.8 |
| Pfam Overlap Label | Reduced |
Seed Sequences
| Protein ID | Range | Length | Seed Sequence |
|---|---|---|---|
| M1E5J2 | 4-77 | 74 | FDYLIFLFYPYVVLSIFVSVSIFRFFYRPYNWKTASSEIFEDKILKLGSNLFHFGILALFLGHLFGLLTPERVF... |
Representative AlphaFold Structure
| AlphaFold ID | Sequence Range | HMM Coverage | Avg pLDDT | AlphaFold 3D Structure |
|---|---|---|---|---|
| AF-Q2FVM4-F1 | 2-75 | 98.67 | 93.87 | View in AlphaFoldDB ↗ |