DPCfam | MC89349
Metacluster Properties and Pfam Annotations
| Number of UniRef50 seed sequences | 71 |
|---|---|
| Mean domain length (aa) | 82 ± 10 aa |
| Residues in low-complexity regions (%) | 1.61 |
| Residues in coiled-coil regions (%) | 0.0 |
| Predicted disordered residues (%) | 16.91 |
| Average transmembrane regions | 0.02 |
| Dominant Pfam architecture(s) | PF11726 |
| Sequences matching dominant architecture (%) | 100.0 |
| Average overlap percent | 45.27 |
| Pfam Overlap Label | Reduced |
Seed Sequences
| Protein ID | Range | Length | Seed Sequence |
|---|---|---|---|
| UPI0009FAD74B | 74-155 | 82 | IESLKARIRYDLIRRRREGKRVHPTSLRYVRVTEVGKSGRPHFHFAIFLNADSYYMGHSNYKSDNGIIGMLRKAWKSALNLP... |
Representative AlphaFold Structure
| AlphaFold ID | Sequence Range | HMM Coverage | Avg pLDDT | AlphaFold 3D Structure |
|---|---|---|---|---|
| AF-P77657-F1 | 68-148 | 97.62 | 91.33 | View in AlphaFoldDB ↗ |