DPCfam | MC89307
Metacluster Properties and Pfam Annotations
| Number of UniRef50 seed sequences | 111 |
|---|---|
| Mean domain length (aa) | 549 ± 58 aa |
| Residues in low-complexity regions (%) | 2.27 |
| Residues in coiled-coil regions (%) | 0.0 |
| Predicted disordered residues (%) | 17.27 |
| Average transmembrane regions | 0.07 |
| Dominant Pfam architecture(s) | UNKNOWN |
| Sequences matching dominant architecture (%) | 0.0 |
| Average overlap percent | 0.0 |
| Pfam Overlap Label | NONE |
Seed Sequences
| Protein ID | Range | Length | Seed Sequence |
|---|---|---|---|
| A0A1A7XS69 | 594-1173 | 580 | LVLNMEGMFEEESQLRRCVEHELLSESISPDQALKRAQQRLKLPVAPSLQRLQVYRWACQALATPPDHPLLPLIWQKFLQLYLRQ... |
Representative AlphaFold Structure
| AlphaFold ID | Sequence Range | HMM Coverage | Avg pLDDT | AlphaFold 3D Structure |
|---|---|---|---|---|
| AF-Q9HCE0-F1 | 1232-1785 | 99.81 | 79.17 | View in AlphaFoldDB ↗ |