DPCfam | MC89231
Metacluster Properties and Pfam Annotations
| Number of UniRef50 seed sequences | 51 |
|---|---|
| Mean domain length (aa) | 131 ± 9 aa |
| Residues in low-complexity regions (%) | 16.67 |
| Residues in coiled-coil regions (%) | 0.0 |
| Predicted disordered residues (%) | 4.11 |
| Average transmembrane regions | 3.41 |
| Dominant Pfam architecture(s) | PF07077 |
| Sequences matching dominant architecture (%) | 37.78 |
| Average overlap percent | 41.99 |
| Pfam Overlap Label | Shifted |
Seed Sequences
| Protein ID | Range | Length | Seed Sequence |
|---|---|---|---|
| K9P9Y1 | 13-142 | 130 | ELRWSAALAVVVLWALERGLPSRFRLLPVGFDFIIFATVLIPMLAVGLTAGRRSWLRIERVTTWLFVAVVGGITLANLAVLIQEM... |
Representative AlphaFold Structure
| AlphaFold ID | Sequence Range | HMM Coverage | Avg pLDDT | AlphaFold 3D Structure |
|---|---|---|---|---|
| AF-K0EHI8-F1 | 16-143 | 98.45 | 84.47 | View in AlphaFoldDB ↗ |