DPCfam | MC8909
Metacluster Properties and Pfam Annotations
| Number of UniRef50 seed sequences | 61 |
|---|---|
| Mean domain length (aa) | 107 ± 12 aa |
| Residues in low-complexity regions (%) | 11.32 |
| Residues in coiled-coil regions (%) | 0.0 |
| Predicted disordered residues (%) | 22.92 |
| Average transmembrane regions | 2.0 |
| Dominant Pfam architecture(s) | UNKNOWN |
| Sequences matching dominant architecture (%) | 0.0 |
| Average overlap percent | 0.0 |
| Pfam Overlap Label | NONE |
Seed Sequences
| Protein ID | Range | Length | Seed Sequence |
|---|---|---|---|
| W2SAJ2 | 11-113 | 103 | HGDNASGGKRGGGLPDGKYDIFVIPPSSAGSGFLYLPSLQVNRNSFIAGAVCMFLVGVIWNTTVPVVKSWFHDTMAGGGSGVMFL... |
Representative AlphaFold Structure
| AlphaFold ID | Sequence Range | HMM Coverage | Avg pLDDT | AlphaFold 3D Structure |
|---|---|---|---|---|
| AF-U7PRD6-F1 | 10-120 | 97.44 | 65.11 | View in AlphaFoldDB ↗ |