DPCfam | MC88952
Metacluster Properties and Pfam Annotations
| Number of UniRef50 seed sequences | 241 |
|---|---|
| Mean domain length (aa) | 329 ± 58 aa |
| Residues in low-complexity regions (%) | 7.15 |
| Residues in coiled-coil regions (%) | 0.92 |
| Predicted disordered residues (%) | 9.66 |
| Average transmembrane regions | 5.02 |
| Dominant Pfam architecture(s) | PF12860 |
| Sequences matching dominant architecture (%) | 29.0 |
| Average overlap percent | 12.62 |
| Pfam Overlap Label | Shifted |
Seed Sequences
| Protein ID | Range | Length | Seed Sequence |
|---|---|---|---|
| A0A1G0MGI6 | 342-534 | 193 | MVMIASMTISTMATNHLLLPLIESVRPLAFAKRYLLQCRWATVAVLVLAGYGFERIVGAYFILVDIGVISFAAALQFAPAIIGGL... |
Representative AlphaFold Structure
| AlphaFold ID | Sequence Range | HMM Coverage | Avg pLDDT | AlphaFold 3D Structure |
|---|---|---|---|---|
| AF-Q9HYX0-F1 | 313-673 | 100.00 | 79.93 | View in AlphaFoldDB ↗ |