DPCfam | MC88299
Metacluster Properties and Pfam Annotations
| Number of UniRef50 seed sequences | 551 |
|---|---|
| Mean domain length (aa) | 246 ± 54 aa |
| Residues in low-complexity regions (%) | 2.64 |
| Residues in coiled-coil regions (%) | 0.0 |
| Predicted disordered residues (%) | 17.6 |
| Average transmembrane regions | 0.02 |
| Dominant Pfam architecture(s) | PF03668 |
| Sequences matching dominant architecture (%) | 96.8 |
| Average overlap percent | 95.94 |
| Pfam Overlap Label | Equivalent |
Seed Sequences
| Protein ID | Range | Length | Seed Sequence |
|---|---|---|---|
| Q97LP3 | 8-284 | 277 | GLSGAGKTQAIRSLEDLGYFCIDNLPPALIPKFAQVCYESESKINKIALVIDIRGGEFFDNLFESLKYLKEAGYKYEILFLDADN... |
Representative AlphaFold Structure
| AlphaFold ID | Sequence Range | HMM Coverage | Avg pLDDT | AlphaFold 3D Structure |
|---|---|---|---|---|
| AF-Q8R8Z8-F1 | 8-281 | 99.63 | 90.73 | View in AlphaFoldDB ↗ |