DPCfam | MC88129
Metacluster Properties and Pfam Annotations
| Number of UniRef50 seed sequences | 161 |
|---|---|
| Mean domain length (aa) | 175 ± 15 aa |
| Residues in low-complexity regions (%) | 6.22 |
| Residues in coiled-coil regions (%) | 3.69 |
| Predicted disordered residues (%) | 35.32 |
| Average transmembrane regions | 0 |
| Dominant Pfam architecture(s) | PF01339 |
| Sequences matching dominant architecture (%) | 99.19 |
| Average overlap percent | 16.89 |
| Pfam Overlap Label | Shifted |
Seed Sequences
| Protein ID | Range | Length | Seed Sequence |
|---|---|---|---|
| X7Y7K4 | 128-318 | 191 | IGVLLSGVLDDGVLGLAAIRSRSGTTIGQTAGDALFPSMPTNARHAGVLDREAAAADIGAVLKELSHRQSKEPTMEPDAALELEN... |
Representative AlphaFold Structure
| AlphaFold ID | Sequence Range | HMM Coverage | Avg pLDDT | AlphaFold 3D Structure |
|---|---|---|---|---|
| AF-P62642-F1 | 136-190 | 32.16 | 98.03 | View in AlphaFoldDB ↗ |