DPCfam | MC88026
Metacluster Properties and Pfam Annotations
| Number of UniRef50 seed sequences | 61 |
|---|---|
| Mean domain length (aa) | 115 ± 10 aa |
| Residues in low-complexity regions (%) | 1.33 |
| Residues in coiled-coil regions (%) | 0.0 |
| Predicted disordered residues (%) | 28.32 |
| Average transmembrane regions | 0 |
| Dominant Pfam architecture(s) | PF09169 |
| Sequences matching dominant architecture (%) | 89.66 |
| Average overlap percent | 63.61 |
| Pfam Overlap Label | Reduced |
Seed Sequences
| Protein ID | Range | Length | Seed Sequence |
|---|---|---|---|
| H0V4T0 | 2373-2493 | 121 | DLMTSLQNARKIQDIRIKEKEKQHIFPQPGSLYLAKTSSLPRISLKAAVGGRVPSACSHKQLYMYGVSIHCMKINSKNAESFKFH... |
Representative AlphaFold Structure
| AlphaFold ID | Sequence Range | HMM Coverage | Avg pLDDT | AlphaFold 3D Structure |
|---|---|---|---|---|
| AF-A0A077YX13-F1 | 266-324 | 54.55 | 74.97 | View in AlphaFoldDB ↗ |