DPCfam | MC87537
Metacluster Properties and Pfam Annotations
| Number of UniRef50 seed sequences | 61 |
|---|---|
| Mean domain length (aa) | 636 ± 121 aa |
| Residues in low-complexity regions (%) | 6.31 |
| Residues in coiled-coil regions (%) | 18.62 |
| Predicted disordered residues (%) | 15.34 |
| Average transmembrane regions | 0.09 |
| Dominant Pfam architecture(s) | UNKNOWN |
| Sequences matching dominant architecture (%) | 0.0 |
| Average overlap percent | 0.0 |
| Pfam Overlap Label | NONE |
Seed Sequences
| Protein ID | Range | Length | Seed Sequence |
|---|---|---|---|
| A0A1V4JI69 | 43-456 | 414 | EPLALWVQIKTDATKQGHEELRLRTLKEALEGHNLDADALVAVLFAELDAYKSVRADTGQERYNVLCDLLQICSERSGRLHPRAV... |
Representative AlphaFold Structure
| AlphaFold ID | Sequence Range | HMM Coverage | Avg pLDDT | AlphaFold 3D Structure |
|---|---|---|---|---|
| AF-Q14674-F1 | 455-1143 | 99.70 | 81.05 | View in AlphaFoldDB ↗ |