DPCfam | MC87343
Metacluster Properties and Pfam Annotations
| Number of UniRef50 seed sequences | 891 |
|---|---|
| Mean domain length (aa) | 165 ± 17 aa |
| Residues in low-complexity regions (%) | 4.4 |
| Residues in coiled-coil regions (%) | 16.86 |
| Predicted disordered residues (%) | 20.78 |
| Average transmembrane regions | 0.01 |
| Dominant Pfam architecture(s) | PF01923 |
| Sequences matching dominant architecture (%) | 98.87 |
| Average overlap percent | 95.63 |
| Pfam Overlap Label | Equivalent |
Seed Sequences
| Protein ID | Range | Length | Seed Sequence |
|---|---|---|---|
| A0A1L8PBD7 | 3-176 | 174 | IYTGRGDYGNTNLIGGGTIKKTDKRVEAYGGIDELNSHVGLLLSLINEEWAVSRNYIKNSLSRIQHQLFDIGSILADKDNKMEMN... |
Representative AlphaFold Structure
| AlphaFold ID | Sequence Range | HMM Coverage | Avg pLDDT | AlphaFold 3D Structure |
|---|---|---|---|---|
| AF-Q96EY8-F1 | 57-232 | 100.00 | 95.61 | View in AlphaFoldDB ↗ |