DPCfam | MC87118
Metacluster Properties and Pfam Annotations
| Number of UniRef50 seed sequences | 211 |
|---|---|
| Mean domain length (aa) | 74 ± 9 aa |
| Residues in low-complexity regions (%) | 0.79 |
| Residues in coiled-coil regions (%) | 0.0 |
| Predicted disordered residues (%) | 16.05 |
| Average transmembrane regions | 0 |
| Dominant Pfam architecture(s) | PF00930 |
| Sequences matching dominant architecture (%) | 98.11 |
| Average overlap percent | 29.08 |
| Pfam Overlap Label | Reduced |
Seed Sequences
| Protein ID | Range | Length | Seed Sequence |
|---|---|---|---|
| H3ANL7 | 390-466 | 77 | YYISNEFQDYPGRRNLYKIKIGDNSSKPQCISCYLRQERCQYYYVYFSKQGTYYRLDCYGPGLPIFTLHRGSNDEEF... |
Representative AlphaFold Structure
| AlphaFold ID | Sequence Range | HMM Coverage | Avg pLDDT | AlphaFold 3D Structure |
|---|---|---|---|---|
| AF-Q9Z218-F1 | 437-505 | 98.65 | 95.07 | View in AlphaFoldDB ↗ |