DPCfam | MC87106
Metacluster Properties and Pfam Annotations
| Number of UniRef50 seed sequences | 61 |
|---|---|
| Mean domain length (aa) | 94 ± 11 aa |
| Residues in low-complexity regions (%) | 7.07 |
| Residues in coiled-coil regions (%) | 0.0 |
| Predicted disordered residues (%) | 64.76 |
| Average transmembrane regions | 0 |
| Dominant Pfam architecture(s) | PF00501 |
| Sequences matching dominant architecture (%) | 2.22 |
| Average overlap percent | 13.17 |
| Pfam Overlap Label | Shifted |
Seed Sequences
| Protein ID | Range | Length | Seed Sequence |
|---|---|---|---|
| G7PWM1 | 181-269 | 89 | AHTHIDLHSAPPDVTTGLVEHSYFERPQVASVRSVPRGCSGSMLETADGVPVNSRVSSKIQQLLNTLKRPKRPPLKEFFVDDFEE... |
Representative AlphaFold Structure
| AlphaFold ID | Sequence Range | HMM Coverage | Avg pLDDT | AlphaFold 3D Structure |
|---|---|---|---|---|
| AF-Q9P265-F1 | 206-304 | 96.94 | 31.14 | View in AlphaFoldDB ↗ |