DPCfam | MC86971
Metacluster Properties and Pfam Annotations
| Number of UniRef50 seed sequences | 241 |
|---|---|
| Mean domain length (aa) | 116 ± 13 aa |
| Residues in low-complexity regions (%) | 22.61 |
| Residues in coiled-coil regions (%) | 0.06 |
| Predicted disordered residues (%) | 61.48 |
| Average transmembrane regions | 0 |
| Dominant Pfam architecture(s) | PF07780 |
| Sequences matching dominant architecture (%) | 98.65 |
| Average overlap percent | 56.36 |
| Pfam Overlap Label | Reduced |
Seed Sequences
| Protein ID | Range | Length | Seed Sequence |
|---|---|---|---|
| A0A183R7K7 | 552-664 | 113 | SLSKAEQAKARKKARLAKRLKRIRQKAEGISDEIPETEKWQQIKQLYKKAGLLKRKRRPLHVVVNTKAGSRSGGTKPQKGAKIKI... |
Representative AlphaFold Structure
| AlphaFold ID | Sequence Range | HMM Coverage | Avg pLDDT | AlphaFold 3D Structure |
|---|---|---|---|---|
| AF-Q4P6G5-F1 | 775-899 | 99.20 | 82.02 | View in AlphaFoldDB ↗ |