DPCfam | MC86879
Metacluster Properties and Pfam Annotations
| Number of UniRef50 seed sequences | 91 |
|---|---|
| Mean domain length (aa) | 91 ± 9 aa |
| Residues in low-complexity regions (%) | 3.21 |
| Residues in coiled-coil regions (%) | 3.63 |
| Predicted disordered residues (%) | 11.87 |
| Average transmembrane regions | 0.16 |
| Dominant Pfam architecture(s) | PF10334 |
| Sequences matching dominant architecture (%) | 58.89 |
| Average overlap percent | 22.19 |
| Pfam Overlap Label | Shifted |
Seed Sequences
| Protein ID | Range | Length | Seed Sequence |
|---|---|---|---|
| G1XH35 | 943-1035 | 93 | LCSRIFQLFYVLSSSMRSGFPLPETLPSIVRSRDRLLMKIHKFRERDRGAGEGRGESEEDFALIYAYVLLTGRVSEGLEKCARSI... |
Representative AlphaFold Structure
| AlphaFold ID | Sequence Range | HMM Coverage | Avg pLDDT | AlphaFold 3D Structure |
|---|---|---|---|---|
| AF-A0A1D8PCH1-F1 | 898-984 | 97.73 | 82.18 | View in AlphaFoldDB ↗ |