DPCfam | MC8680
Metacluster Properties and Pfam Annotations
| Number of UniRef50 seed sequences | 51 |
|---|---|
| Mean domain length (aa) | 131 ± 20 aa |
| Residues in low-complexity regions (%) | 12.48 |
| Residues in coiled-coil regions (%) | 0.0 |
| Predicted disordered residues (%) | 38.0 |
| Average transmembrane regions | 0 |
| Dominant Pfam architecture(s) | PF10479 |
| Sequences matching dominant architecture (%) | 95.0 |
| Average overlap percent | 10.35 |
| Pfam Overlap Label | Shifted |
Seed Sequences
| Protein ID | Range | Length | Seed Sequence |
|---|---|---|---|
| A0A1W4X7F8 | 1113-1262 | 150 | MRRLTEILAFPKAWYRRSIVRRLFLGDLSMSAAYNDDDDSMLNSSGVSSQRHEPRTPKSSEKSPLLGKDKIKSPLDADASRQSKF... |
Representative AlphaFold Structure
| AlphaFold ID | Sequence Range | HMM Coverage | Avg pLDDT | AlphaFold 3D Structure |
|---|---|---|---|---|
| AF-A0A3P7GJ31-F1 | 59-106 | 39.06 | 46.36 | View in AlphaFoldDB ↗ |